PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G2287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 300aa    MW: 33623.7 Da    PI: 7.2484
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G2287genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEd++lv+ ++ +G g+W+++++  g+ R++k+c++rw +yl
      Gh_A08G2287 13 RGLWSPEEDDKLVKHITTHGHGSWSSVPKLAGLQRCGKSCRLRWINYL 60
                     788*******************************************97 PP

2Myb_DNA-binding56.85.3e-1866109146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE+++++d+++ lG++ W+ Ia++++ gRt++++k++w++
      Gh_A08G2287  66 RGSFTAEEEQIIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-25563IPR009057Homeodomain-like
PROSITE profilePS5129417.457860IPR017930Myb domain
SuperFamilySSF466897.86E-3010107IPR009057Homeodomain-like
SMARTSM007172.2E-121262IPR001005SANT/Myb domain
PfamPF002492.3E-151360IPR001005SANT/Myb domain
CDDcd001671.47E-101660No hitNo description
PROSITE profilePS5129427.22861115IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2664115IPR009057Homeodomain-like
SMARTSM007177.4E-1765113IPR001005SANT/Myb domain
PfamPF002493.4E-1666109IPR001005SANT/Myb domain
CDDcd001671.43E-1268108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGHRCCSKQK VKRGLWSPEE DDKLVKHITT HGHGSWSSVP KLAGLQRCGK SCRLRWINYL  60
RPDLKRGSFT AEEEQIIIDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLLSQGL  120
DPKTHNLLSS RQRASNKLAC KYSSSSPSSQ SQHGSFTVFN ITSHAKDTNN NNNNNNTMMM  180
NPPPPVVTFP HQSPNPNTTY AQNLYGSSMD TPFVSSSSCF GNMLYESDPC IWDDANAVVE  240
TFEEPRVDSL PPMPQPQQQE NDDKIDMDCS LMEGGAGSFD LGLLESTLLS AAMDDFGWNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6190811e-133JX619081.1 Gossypium hirsutum clone NBRI_GE64810 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478043.10.0PREDICTED: transcription repressor MYB6
TrEMBLA0A0D2R4U30.0A0A0D2R4U3_G
STRINGPOPTR_0008s08110.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79552539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.17e-87myb domain protein 67